ProductsIn-Vitro DiagnosticPrimary AntibodiesSecondary AntibodiesNormal Sera
(non-immune)
Immunochemicals
& Labeling Kits
Best
Sellers
ServicesOEM ManufacturingCustom Antibody
Development and Scale-Up
Custom ImmunochemistryAssay Development ServiceAssay ServiceAnimal Housing and Care
View Cart  | Shipping 
 | Tax 
 | Terms
 Shopping Cart 0 Items
All Categories > Primary Antibodies > NeuroMabs > Scaffold Proteins > Item # 73-187  
Download PDF Download PDF     Printable Page     Email Email This Page     Save To Favorites Save To Favorites

Item # 73-187, Ankyrin-G (Blotting)



Immunogen:
Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence:
EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH
Human: 92% identity (920/994 amino acids identical, accession # E9PE32)
Mouse: 89% identity (837/936 amino acids identical)
Rat: 87% identity (820/935 amino acids identical)
<50% identity with Ankyrin-B





 Specifications   

Target

Ankyrin-G (Blotting)

Applications

Immunoblot (IB)
Immunocytochemistry (ICC)

Clone

N106/20

IgG Isotype

IgG1

Species Reactivity

Human (H)
Mouse (M)

Rat (R)

Validation

Br-IB
T

Type

TC Supernatant

Format

5 mL

Expected Banding Pattern

>200 kDa

Host

Mouse (M)

Label

Unlabeled

Antibody Type

Monoclonal

Commercial Price

390

Non-Profit Price

175

Distributor Price

Per Contract(QUOTE)

ABID

RRID:AB_10674433


 DOWNLOADS 

75-187_73-187_Ankyrin-G (Blotting)_Datasheet



 NeuroMabs Item Promotions 


Goat Polyclonal Antisera
48-146-3H
Goat Anti-Mouse - IgG - HRP
$167.00