ProductsIn-Vitro DiagnosticPrimary AntibodiesSecondary AntibodiesNormal Sera
(non-immune)
Immunochemicals
& Labeling Kits
Best
Sellers
ServicesOEM ManufacturingCustom Antibody
Development and Scale-Up
Custom ImmunochemistryAssay Development ServiceAssay ServiceAnimal Housing and Care
View Cart  | Shipping 
 | Tax 
 | Terms
 Shopping Cart 0 Items
All Categories > Primary Antibodies > NeuroMabs > Scaffold Proteins > Item # 75-146  
Download PDF Download PDF     Printable Page     Email Email This Page     Save To Favorites Save To Favorites

Item # 75-146, Ankyrin-G (Staining)



Immunogen:
Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence:
EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH

Human: 92% identity (920/994 amino acids identical, accession # E9PE32)
Mouse: 89% identity (837/936 amino acids identical)
Rat: 87% identity (820/935 amino acids identical)
<50% identity with Ankyrin-B






 Specifications   

Target

Ankyrin-G (Staining)

Applications

Immunocytochemistry (ICC)
Immunohistochemistry (IHC)

Clone

N106/36

IgG Isotype

IgG2a

Species Reactivity

Human (H)
Mouse (M)

Rat (R)

Validation

Br-IHC
T

Type

Purified

Format

100 ul

Cross Reactivity

Does not cross-react with Ankyrin-B

Host

Mouse (M)

Label

Unlabeled

Antibody Type

Monoclonal

Commercial Price

450

Non-Profit Price

200

Distributor Price

Per Contract(QUOTE)

ABID

RRID:AB_10673030


 DOWNLOADS 

75-146_73-146_Ankyrin-G (Staining)_Datasheet



 NeuroMabs Item Promotions 


Goat Polyclonal Antisera
48-146-3H
Goat Anti-Mouse - IgG - HRP
$167.00